CJC-1295 Without DAC Muscle Building 863288-34-0 Peptide Human Growth
Product information
| Product Name | CJC1295 |
| Synonyms | CJC1295;Y(d -A)DAIFTQSYRKVLAQLSARKLLQDILSR-NH2;L-Tyrosyl-D-alanyl-L-alpha-aspartyl-L-alanyl-L-isoleucyl-L-phenylalanyl-L-threonyl-L-glutaminyl-L-seryl-L-tyrosyl-L-arginyl-L-lysyl-L-valyl-L-leucyl-L-alanyl-L-glutaminyl-L-seryl-L-alanyl-L-arginyl-L-lysyl-L-leucyl-L-leucyl-L-glutaminyl-L-alpha-aspartyl-L-isoleucyl-L-leucyl-L-seryl-L-arginyl-N6-[3-(2,5-dihydro-2,5-dioxo-1H-pyrrol-1-yl)-1-oxopropyl]-L-lysinamide;CJC-1295 CJC-1295;CJC-1295 Acetate;CJC1295 with out DAC;-L-arginyl-L-lysyl-L-leucyl-L-leucyl-L-glutaminyl;CJC-1295(2MG) |
| CAS | 863288-34-0 |
| MF | C152H252N44O42 |
| MW | 3367.89688 |
| EINECS | 206-141-6 |
| Melting point | > 177° C (dec.) |
| density | 1.45 |
| storage temp. | -20°C Freezer, Under inert atmosphere |
| solubility | Ethanol (Slightly, Heated, Sonicated), Methanol (Slightly), Water (Slightly) |
| form | Solid |
| color | White to Off-White |
| Usage | Do not sell to personal,for research only |
| Storage | Keep in cool, dry place, tightly sealed container |
Product Packing
Packing size: 1g;5g;10g;50g;100g;1kg Foil bags; 25kg Drums
Customized packing available
Shipping
| Express(3-8 days) | DHL/TNT/Fedex |
| By Air(8-15 days) | To airport only,customer deal with customs clearance in destination airport ;Suitable for large quantity like 50kg to hundreds of kgs |
| Door to door(8-15days) | Most efficient way under 100kg Special line service |
| By Sea(20-40 days) | To seaport only,customer deal with customs clearance in destination seaport; Suitable for large goods,hundreds of kgs to container;Cheaper but longer time. |
Our advantages
RFQ
Q: What's your MOQ ?
A: For the high value product, our MOQ starts from 1g and generally starts from 10gs.
For other low, price product, our MOQ starts from 100g and 1kg.
Q: Is there a discount ?
A: Yes, for larger quantity, we always support with better price.
Q: How to confirm the Product Quality before placing orders ?
A: You can get free samples for some proucts, you only need to pay the shipping cost or arrange a courier to us and take the samples. You can send us your product specifications and requests, we will manufacture the products according to your requests.
Q: How to start orders or make payments ?
A: You can send our your Purchase order ( if your company has ), or just send a simple confirmation by email or by Trade Manager, and we will send you Proforma Invoice with our bank details for your confirmation, then you can make payment accordingly.
Q: How do you treat quality complaint ?
A: First of all, our quality control will reduce the quality problem to near zero. If there is a quality problem caused by us, we will send you free goods for replacement or refund your loss.
