page_banner

product

CJC-1295 Without DAC Muscle Building 863288-34-0 Peptide Human Growth

Short Description:

Product Name: CJC-1295
CAS Number: 863288-34-0
Purity: ≥99%

  • FOB Price: US $0.1 - 1,000 / grams
  • Min.Order Quantity: 1-100 grams
  • Product Detail

    Product Tags

    Product information

    Product Name CJC1295
    Synonyms CJC1295;Y(d -A)DAIFTQSYRKVLAQLSARKLLQDILSR-NH2;L-Tyrosyl-D-alanyl-L-alpha-aspartyl-L-alanyl-L-isoleucyl-L-phenylalanyl-L-threonyl-L-glutaminyl-L-seryl-L-tyrosyl-L-arginyl-L-lysyl-L-valyl-L-leucyl-L-alanyl-L-glutaminyl-L-seryl-L-alanyl-L-arginyl-L-lysyl-L-leucyl-L-leucyl-L-glutaminyl-L-alpha-aspartyl-L-isoleucyl-L-leucyl-L-seryl-L-arginyl-N6-[3-(2,5-dihydro-2,5-dioxo-1H-pyrrol-1-yl)-1-oxopropyl]-L-lysinamide;CJC-1295 CJC-1295;CJC-1295 Acetate;CJC1295 with out DAC;-L-arginyl-L-lysyl-L-leucyl-L-leucyl-L-glutaminyl;CJC-1295(2MG)
    CAS 863288-34-0
    MF C152H252N44O42
    MW 3367.89688
    EINECS 206-141-6
    Melting point > 177° C (dec.)
    density 1.45
    storage temp. -20°C Freezer, Under inert atmosphere
    solubility Ethanol (Slightly, Heated, Sonicated), Methanol (Slightly), Water (Slightly)
    form Solid
    color White to Off-White
    Usage Do not sell to personal,for research only
    Storage Keep in cool, dry place, tightly sealed container

    Product Packing

    微信截图_20230625162513

    Packing size: 1g;5g;10g;50g;100g;1kg Foil bags; 25kg Drums
    Customized packing available

    Shipping

    Express(3-8 days) DHL/TNT/Fedex
    By Air(8-15 days) To airport only,customer deal with customs clearance in destination airport ;Suitable for large quantity like 50kg to hundreds of kgs
    Door to door(8-15days) Most efficient way under 100kg Special line service
    By Sea(20-40 days) To seaport only,customer deal with customs clearance in destination seaport; Suitable for large goods,hundreds of kgs to container;Cheaper but longer time.

    Our advantages

    Advance

    RFQ

    Q: What's your MOQ ?
    A: For the high value product, our MOQ starts from 1g and generally starts from 10gs.
    For other low, price product, our MOQ starts from 100g and 1kg.

    Q: Is there a discount ?
    A: Yes, for larger quantity, we always support with better price.

    Q: How to confirm the Product Quality before placing orders ?
    A: You can get free samples for some proucts, you only need to pay the shipping cost or arrange a courier to us and take the samples. You can send us your product specifications and requests, we will manufacture the products according to your requests.

    Q: How to start orders or make payments ?
    A: You can send our your Purchase order ( if your company has ), or just send a simple confirmation by email or by Trade Manager, and we will send you Proforma Invoice with our bank details for your confirmation, then you can make payment accordingly.

    Q: How do you treat quality complaint ?
    A: First of all, our quality control will reduce the quality problem to near zero. If there is a quality problem caused by us, we will send you free goods for replacement or refund your loss.


  • Previous:
  • Next:

  • Write your message here and send it to us